Protein coding transcript 31407

• Transcript: Ll_transcript_513157
• CDS coordinates: 3-890 (+)
• Peptide sequence: YSTHTPLSAVALSFSSLKPSMAERGGDRGGFGRGFGDRGRGGRGDRGRGGRRRGPRREEEEKWVPVTKLGRLVKDGKIRSLEQIYLHSLPIKEHQIIDTLVGPSLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDNNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLLKTYGFLTPEFWKETRFSKSPFQEYTDLLARPTTKALILEEEKVPAEA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_513157

• Blastp: 40S ribosomal protein S2-4 from Arabidopsis with 92.31% of identity
• Blastx: 40S ribosomal protein S2-4 from Arabidopsis with 92.31% of identity
• Eggnog: Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body (By similarity)(COG0098)
• Kegg: Link to kegg annotations (AT3G57490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446212.1)
• Pfam: Ribosomal protein S5, N-terminal domain (PF00333.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;