Protein coding transcript 31525

• Transcript: Ll_transcript_312220
• CDS coordinates: 478-882 (+)
• Peptide sequence: MMEEDKYIQASTKGKNVQTFSSCSEQQHQNPRKKKNRLEKNKRRFSDEQIKSLECIFESESMLEPRKKLQLASDLGLQPRQVAIWFQNRRARWKSKRMEQEYRKLRDEYEKLASRFESLKNEKEFLQLQVKSIL*
• ORF Type: complete

Annotations of Ll_transcript_312220

• Blastp: Homeobox-leucine zipper protein ATHB-7 from Arabidopsis with 71.28% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-7 from Arabidopsis with 74.39% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410Z2UE)
• Kegg: Link to kegg annotations (AT2G46680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433620.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;