Transcript | Ll_transcript_312225 |
---|---|
CDS coordinates | 478-1191 (+) |
Peptide sequence | MMEEDKYIQASTKGKNVQTFSSCSEQQHQNPRKKKNRLEKNKRRFSDEQIKSLECIFESESMLEPRKKLQLASDLGLQPRQVAIWFQNRRARWKSKRMEQEYRKLRDEYEKLASRFESLKNEKEFLQLQLQKLKENSAEEGGSGSGYDHWRVEVKPSFSDEGLENRECMNYPDDKNEKNMRIEKSEERGQEQHQVLRMDEHEEILPLTSTLGKWDNVDPNGILDQSCSSSQWLDFWT* |
ORF Type | complete |
Blastp | Homeobox-leucine zipper protein ATHB-7 from Arabidopsis with 43.93% of identity |
---|---|
Blastx | Homeobox-leucine zipper protein ATHB-7 from Arabidopsis with 75.68% of identity |
Eggnog | homeobox-leucine zipper protein(ENOG410Z2UE) |
Kegg | Link to kegg annotations (AT2G46680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433620.1) |
Pfam | Homeobox domain (PF00046.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer