Protein coding transcript 3158

• Transcript: Ll_transcript_468882
• CDS coordinates: 160-561 (+)
• Peptide sequence: MMPQMRKQGQGRGRRIWRRRKLTKEDEYLEQKMERIPFLEEQVRMIKDQGKLLTMDIERLLLSEDNRFDFVNEIAAEANSYVENNMDDYGLEKKAILHVLSNRMNDAGFYRPEAYAESDPFKPGPHFLKEELP*
• ORF Type: complete

Annotations of Ll_transcript_468882

• Blastp: Protein PLASTID TRANSCRIPTIONALLY ACTIVE 7 from Arabidopsis with 66.95% of identity
• Blastx: Protein PLASTID TRANSCRIPTIONALLY ACTIVE 7 from Arabidopsis with 66.06% of identity
• Eggnog: NA(ENOG410YIZX)
• Kegg: Link to kegg annotations (AT5G24314)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415997.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;