Protein coding transcript 31585

• Transcript: Ll_transcript_313190
• CDS coordinates: 233-1120 (+)
• Peptide sequence: MATTFSGLQFALSRPCIPSTQRFADAGTMVLGGKSKVGAWNNLTSASHVASVQPLRQSLTSSSIKSVKTVTKAMSESSADTPVSGLPINLKGKRAFIAGVADDHGYGWAIAKSLAAAGAEILVGTWVPALNIFESSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDNLEDVPEDIKTNKRYAGSSKWTVQEVAESVKEDFGSIDILVHSLANGPEVTKPLLETSRKGYLAAISASSYSYVSLLKHFLPILNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVSFELFS*
• ORF Type: complete

Annotations of Ll_transcript_313190

• Blastp: Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic from Arabidopsis with 73.7% of identity
• Blastx: Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic from Arabidopsis with 64.96% of identity
• Eggnog: Enoyl- acyl-carrier-protein reductase NADH(COG0623)
• Kegg: Link to kegg annotations (AT2G05990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450932.1)
• Pfam: Enoyl-(Acyl carrier protein) reductase (PF13561.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;