Transcript | Ll_transcript_468883 |
---|---|
CDS coordinates | 210-665 (+) |
Peptide sequence | MELRAVNSWSPRFCVCSKMMPQMRKQGQGRGRRIWRRRKLTKEDEYLEQKMERIPFLEEQVRMIKDQGKLLTMDIERLLLSEDNRFDFVNEIAAEANSYVENNMDDYGLEKKAILHVLSNRMNDAGFYRPEAYAESDPFKPGPHFLKEELP* |
ORF Type | complete |
Blastp | Protein PLASTID TRANSCRIPTIONALLY ACTIVE 7 from Arabidopsis with 66.95% of identity |
---|---|
Blastx | Protein PLASTID TRANSCRIPTIONALLY ACTIVE 7 from Arabidopsis with 66.06% of identity |
Eggnog | NA(ENOG410YIZX) |
Kegg | Link to kegg annotations (AT5G24314) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415997.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer