Protein coding transcript 31641

• Transcript: Ll_transcript_314045
• CDS coordinates: 2775-3281 (+)
• Peptide sequence: MAGSGCENTEKVEQILEQVNGNVDAAIEFLIAEQGREECSATSDFFPSQADADGHDENENLEHKEHTVEDSVNAKSNDRSTKTNNNSTLQPTDKIPRNKFCPCGSKKKYKACCGSVLGKQHAKLVINQADDSRKGKKERKQGKKGISSKAEAPYEYDSVTLDVGALCI*
• ORF Type: complete

Annotations of Ll_transcript_314045

• Blastp: Protein translocase subunit SecA from Thiomicrospira with 40.82% of identity
• Blastx: OTU domain-containing protein 3 from Mus with 51.02% of identity
• Eggnog: Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to the transfer of proteins into and across the cell membrane, serving(COG0653)
• Kegg: Link to kegg annotations (Tcr_0589)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422192.1)
• Pfam: SEC-C motif (PF02810.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;