Protein coding transcript 31648

• Transcript: Ll_transcript_314057
• CDS coordinates: 103-720 (+)
• Peptide sequence: MVKRKQQKKQSHKKQEQPQNKKQGKQDDASQFWTQLDVLGLRIVEVTADGNCFFRALADQLEGNEEEHRKYRSMIVKHILDNREMFEPFIEDEVPFDEYCRSMETGGTWAGHMELQAASLVTHSNICIHRSMTPRWYIRNFDDRGARMIHLSYHDGEHYNSVRLKDDPCDGPAKSIVIKRHHIKQKLQLTNPVSGLIKELVCQGP*
• ORF Type: complete

Annotations of Ll_transcript_314057

• Blastp: OTU domain-containing protein 3 from Mus with 38.01% of identity
• Blastx: OTU domain-containing protein 3 from Mus with 43.66% of identity
• Eggnog: OTU domain containing 3(ENOG4110S6T)
• Kegg: Link to kegg annotations (73162)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422192.1)
• Pfam: OTU-like cysteine protease (PF02338.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;