Transcript | Ll_transcript_314034 |
---|---|
CDS coordinates | 103-1116 (+) |
Peptide sequence | MVKRKQQKKQSHKKQEQPQNKKQGKQDDASQFWTQLDVLGLRIVEVTADGNCFFRALADQLEGNEEEHRKYRSMIVKHILDNREMFEPFIEDEVPFDEYCRSMETGGTWAGHMELQAASLVTHSNICIHRSMTPRWYIRNFDDRGARMIHLSYHDGEHYNSVRLKDDPCDGPAKSIVIKADADLSATSHQAKVTANKSRERTDKGTCLPGSIKLVMAGSGCENTEKVEQILEQVNGNVDAAIEFLIAEQGREECSATSDFFPSQADADGHDENENLEHKEHTVEDSVNAKSNDRSTKTNNNSTLQPTDKVIFLFYFLFVRGTRRGDIEMIQCSCDLI* |
ORF Type | complete |
Blastp | OTU domain-containing protein 3 from Mus with 33.47% of identity |
---|---|
Blastx | OTU domain-containing protein 3 from Mus with 36.32% of identity |
Eggnog | OTU domain containing 3(ENOG4110S6T) |
Kegg | Link to kegg annotations (73162) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422192.1) |
Pfam | OTU-like cysteine protease (PF02338.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer