Protein coding transcript 31660

• Transcript: Ll_transcript_314022
• CDS coordinates: 837-1376 (+)
• Peptide sequence: MLSEKVHRTKALIECEGDSIDLSGDMGAVGRIVVSDSPSGDKEMYIDLKGTIYKTSIVPCRTFCIVSFGQSEAKIEAVMNDFIQLKPQSNVYEAETMVEGTWDGLSFDSDEEGGKMQKSTHQTDQNEDAEEQPNAKSKGKANKTSGAEKKRGRSTAAARPQSKTVKKKNVASKRAKTKK*
• ORF Type: complete

Annotations of Ll_transcript_314022

• Blastp: DNA-binding protein BIN4 from Arabidopsis with 62.05% of identity
• Blastx: DNA-binding protein BIN4 from Arabidopsis with 60.96% of identity
• Eggnog: NA(ENOG410Y5VT)
• Kegg: Link to kegg annotations (AT5G24630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437288.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;