Transcript | Ll_transcript_314022 |
---|---|
CDS coordinates | 837-1376 (+) |
Peptide sequence | MLSEKVHRTKALIECEGDSIDLSGDMGAVGRIVVSDSPSGDKEMYIDLKGTIYKTSIVPCRTFCIVSFGQSEAKIEAVMNDFIQLKPQSNVYEAETMVEGTWDGLSFDSDEEGGKMQKSTHQTDQNEDAEEQPNAKSKGKANKTSGAEKKRGRSTAAARPQSKTVKKKNVASKRAKTKK* |
ORF Type | complete |
Blastp | DNA-binding protein BIN4 from Arabidopsis with 62.05% of identity |
---|---|
Blastx | DNA-binding protein BIN4 from Arabidopsis with 60.96% of identity |
Eggnog | NA(ENOG410Y5VT) |
Kegg | Link to kegg annotations (AT5G24630) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437288.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer