| Transcript | Ll_transcript_314030 |
|---|---|
| CDS coordinates | 350-655 (+) |
| Peptide sequence | MNDFIQLKPQSNVYEAETMVEGTWDGLSFDSDEEGGKMQKSTHQTDQNEDAEEQPNAKSKGKANKTSGAEKKRGRSTAAARPQSKTVKKKNVASKRAKTKK* |
| ORF Type | complete |
| Blastp | DNA-binding protein BIN4 from Arabidopsis with 51.14% of identity |
|---|---|
| Blastx | Proteasome subunit beta type-3 from Picea with 90.38% of identity |
| Eggnog | NA(ENOG410Y5VT) |
| Kegg | Link to kegg annotations (AT5G24630) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437290.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer