Protein coding transcript 31690

• Transcript: Ll_transcript_312750
• CDS coordinates: 313-1110 (+)
• Peptide sequence: MLQCIFLVSDSGEVMLEKQLTGHRVDRSICAWFWDQAISQGDSFKQQPVIASPTHYLFQVVREGITFLACTQVEMPPLMAIEFLCRVADVLNDYLGGLNEDLIKDNFVIVYELLDEMIDNGFPLTTEPNILQEMIAPPNLVSKVLSVVTGSSSNVSDTLPGATASCVPWRTADPKYANNEIYVDLAEEMDATINRDGFLVKCEIYGEVQVNSHITGLPDLTLSFANPSILDSVRFHPCVRFRPWESNQILSFVPPDGQFKLMSYR*
• ORF Type: complete

Annotations of Ll_transcript_312750

• Blastp: AP-3 complex subunit mu from Arabidopsis with 85.28% of identity
• Blastx: AP-3 complex subunit mu from Arabidopsis with 72.44% of identity
• Eggnog: adaptor-related protein complex 3, mu(ENOG410XT7B)
• Kegg: Link to kegg annotations (AT1G56590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422491.1)
• Pfam: Adaptor complexes medium subunit family (PF00928.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;