Protein coding transcript 31738

• Transcript: Ll_transcript_312789
• CDS coordinates: 2-514 (+)
• Peptide sequence: YVLSKIPGNEKEYLSSDSVDMSDANESEAFKILTPEFLNSLATSGLPNHKIKLKVGTSIMLLRNLDQSGGLCNGTRLVVTMMTNHVFEAKIMSGKNIGNITYIPRLSMSPSQSPWTFTLIRRQFPIIVSYAMTINKSQGQSLESVGLYLPKPVFSYGQLYVAISRVQTKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_312789

• Blastp: ATP-dependent DNA helicase PIF1 from Xenopus with 31.58% of identity
• Blastx: ATP-dependent DNA helicase PIF1 from Xenopus with 30.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (734585)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457526.1)
• Pfam: PIF1-like helicase (PF05970.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;