Protein coding transcript 31740

• Transcript: Ll_transcript_312795
• CDS coordinates: 3-377 (+)
• Peptide sequence: RLVVTKMANHVIEAKIMSGKNIGNITYIPRLSMSPSQSPWTFTLIRRQFPIIVSYAMTINKSQGQSLESVGLYLPKPVFSHGQLYVAILRVQTKKGLKMLIHDKDVKPLRSTTNVVYKEVFQNL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_312795

• Blastp: ATP-dependent DNA helicase pfh1 from Schizosaccharomyces with 47.27% of identity
• Blastx: ATP-dependent DNA helicase pfh1 from Schizosaccharomyces with 47.27% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC887.14c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457526.1)
• Pfam: Helicase (PF02689.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;