| Transcript | Ll_transcript_313860 |
|---|---|
| CDS coordinates | 1-369 (+) |
| Peptide sequence | CELGQASLMISEIIFVCFTIYGVNGNFFELLLQMTRMFGMGDDFGDDAIVGRLEGMKEVIEQVNKQFKDPDMTTFVCVCIPEFLSLYETERLVQELTKFEIDTHNIIINQVLFDDEDVESKLL |
| ORF Type | internal |
| Blastp | ATPase ASNA1 homolog from Brugia with 57.29% of identity |
|---|---|
| Blastx | ATPase get3 from Schizosaccharomyces with 67.65% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (Bm1_42140) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460892.1) |
| Pfam | Anion-transporting ATPase (PF02374.14) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer