Protein coding transcript 31855

• Transcript: Ll_transcript_313530
• CDS coordinates: 292-798 (+)
• Peptide sequence: MATPSSSTSQSHFTYSNNASSSYFPVPFHLQQHSTTHYTAPYVPPAVQIPVPPVIGPVPPAPVAAVYSVPQYPAQQLFERDAQIITPEALESVKAAIASSEVENKADTKKKAIPRKAAGQTWEDPVLAEWPEDDYRLFCGDLGNEVNDDVLSKAFSRFPSFNMARIYV*
• ORF Type: complete

Annotations of Ll_transcript_313530

• Blastp: RNA-binding protein 42 from Bos with 69.23% of identity
• Blastx: RNA-binding protein 42 from Danio with 68.66% of identity
• Eggnog: RNA binding motif protein 42(ENOG4111N9B)
• Kegg: Link to kegg annotations (540172)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426500.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;