Protein coding transcript 31874

• Transcript: Ll_transcript_312543
• CDS coordinates: 84-524 (+)
• Peptide sequence: MEQPSLELQLVENSNYTTLSKEVADKSHLLRQMRGEDLHGLDIDELQQLERSLEDGLGRVIQKKGEKIMNEITDLQSKGMRLMEENERLKRQVANITNGQMHESENIVGDEAGQSSAESATNFGTGPPHDSDSSDTSLKLGLPYQG*
• ORF Type: complete

Annotations of Ll_transcript_312543

• Blastp: MADS-box protein SVP from Arabidopsis with 59.51% of identity
• Blastx: MADS-box protein SVP from Arabidopsis with 59.76% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT2G22540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421406.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;