Protein coding transcript 31877

• Transcript: Ll_transcript_311883
• CDS coordinates: 2049-2918 (+)
• Peptide sequence: MQHLYKNQLQNYAHKKNLNLPAYSSEWEGPPHALRFKCKVTIDGQTFESSKFFSTLKDAEHAAAEVALMSLSPGGVQEDQTGLYKNLLQEFAQKEGFRLPSYNTNRYGESHMPTFVSQVEIEGESFTGQEAKSKKQAETSAAKVAYMTLKERKAHCGQAPDFSSDCSEANVITGLQHHANLRSPVSPGLVAKNHLDKSKEPVAFTEKKGSCSSSSGNSNGCTKNSSLTNAQSEPSLSESSNVISDTSKMASSCRVKVIVYSRNTNVEIEGGGSIMPISDDKWLAYSFSH*
• ORF Type: complete

Annotations of Ll_transcript_311883

• Blastp: Double-stranded RNA-binding protein 4 from Arabidopsis with 54.76% of identity
• Blastx: Double-stranded RNA-binding protein 4 from Arabidopsis with 55.36% of identity
• Eggnog: Double-stranded RNA binding motif(ENOG410YPSH)
• Kegg: Link to kegg annotations (AT3G62800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427615.1)
• Pfam: Double-stranded RNA binding motif (PF00035.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;