Protein coding transcript 31884

• Transcript: Ll_transcript_311891
• CDS coordinates: 1-465 (+)
• Peptide sequence: LYLCLTALVQVCRNAETGESKGCAYVTLGSINSARNAVSALDGLDVGGREMRVRFSVEMNRRGKNLKILNSSPRKVIYYEGPHKLYVGNLPKPVSPEELRHLFVKFGTVASLRILIDQREGRTRVYAFVSFLSENERDAAMSINGIVKSVLPTS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_311891

• Blastp: 33 kDa ribonucleoprotein, chloroplastic from Nicotiana with 32.12% of identity
• Blastx: 33 kDa ribonucleoprotein, chloroplastic from Nicotiana with 32.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419239.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;