Protein coding transcript 31980

• Transcript: Ll_transcript_312058
• CDS coordinates: 156-629 (+)
• Peptide sequence: MEFIGFLVEHNVDMTSVKKYAVDDDVPPSKPIDEEQNYEPKKGNVGPSDSTIANNCGQDNVGNFGNYLKTSQVKEMKPLSSKWTTGAGPRIGCVREYPTKLQVKALEQLNLSPRLNHAKFDAKAPIPSPRPSPKIHLSPRLVQMGIPSPRVHVNPTN*
• ORF Type: complete

Annotations of Ll_transcript_312058

• Blastp: IQ domain-containing protein IQM5 from Arabidopsis with 47.65% of identity
• Blastx: IQ domain-containing protein IQM5 from Arabidopsis with 49.7% of identity
• Eggnog: Calmodulin-binding(ENOG410XYNX)
• Kegg: Link to kegg annotations (AT5G57010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443508.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;