Protein coding transcript 31986

• Transcript: Ll_transcript_312065
• CDS coordinates: 98-694 (+)
• Peptide sequence: MEENGERNSKNGSFKLGVKDVKIHTVVELSNVDTHNLLVDYCSDVEEDREKEKKPFKNSLSQRQMKSLVAICDTLLPSIVKDHTVVDESVANFYQTSASMAGTPELIGTLISEKLQHPNTWLLKLTLWLLSTWFGTLILCGISSFSLNFPFFHSFSQLSLQKRQQIMLSWSLSYFNLLRMFFRSVKLLTLLIFFTQVN*
• ORF Type: complete

Annotations of Ll_transcript_312065

• Blastp: Long-chain-alcohol oxidase FAO4A from Arabidopsis with 52.94% of identity
• Blastx: Long-chain-alcohol oxidase FAO4A from Arabidopsis with 53.33% of identity
• Eggnog: oxidoreductase(COG2303)
• Kegg: Link to kegg annotations (AT4G19380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446944.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;