| Transcript | Ll_transcript_312007 |
|---|---|
| CDS coordinates | 2-334 (+) |
| Peptide sequence | EELTTTQSPLPFCRWGMDILGPFPQATGQLEFLIVAIDYFTKWIEAEALATITSANIQKFTWQNIITRFGIPSTIVTDNGTQFADRRFQELLLGLHIKTWMDEIGKGHTG* |
| ORF Type | 5prime_partial |
| Blastp | Pol polyprotein from Gammaretrovirus with 36% of identity |
|---|---|
| Blastx | Pol polyprotein from Gammaretrovirus with 30.77% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418559.1) |
| Pfam | Integrase core domain (PF00665.25) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer