Transcript | Ll_transcript_312283 |
---|---|
CDS coordinates | 35-955 (+) |
Peptide sequence | MRTMTLFCLSSNLSPLPKLNPSSSTKSLPSITVTTGRRTLVSSLVMPFLLNLATPLSFAHQILDQEDNLVQLFKETSPSVVFIKDLELSKVPKASSNEVMQLKEDEDAKVEGTGSGFIWDKYGHIVTNYHVVAKLATDTNGLQRCKVSLVDAKGNSFYRDGKIIGFDPAYDLAVLKVDVDGYEIKPAVLGQSNNLHVGQSCFAIGNPFGYENTLTTGVVSGLGREIPSPNGGAIKGAIQTDAPINAGNSGGPLVDSYGHVIGVNTATFTKKGTGLSSGVNFAIPIDTVLRNVPYLIVYGTPYSNRF* |
ORF Type | complete |
Blastp | Protease Do-like 5, chloroplastic from Arabidopsis with 72.57% of identity |
---|---|
Blastx | Protease Do-like 5, chloroplastic from Arabidopsis with 72.57% of identity |
Eggnog | Serine protease(COG0265) |
Kegg | Link to kegg annotations (AT4G18370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419359.1) |
Pfam | Trypsin-like peptidase domain (PF13365.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer