Protein coding transcript 32104

• Transcript: Ll_transcript_312285
• CDS coordinates: 35-481 (+)
• Peptide sequence: MRTMTLFCLSSNLSPLPKLNPSSSTKSLPSITVTTGRRTLVSSLVMPFLLNLATPLSFAHQILDQEDNLVQLFKETSPSVVFIKDLELSKVPKASSNEVMQLKEDEDAKVEGTGSGFIWDKYGHIVTNYHVVAKLATDTNGLQRCVPS*
• ORF Type: complete

Annotations of Ll_transcript_312285

• Blastp: Protease Do-like 5, chloroplastic from Arabidopsis with 64.47% of identity
• Blastx: Protease Do-like 5, chloroplastic from Arabidopsis with 64.47% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (AT4G18370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418194.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;