Protein coding transcript 32203

• Transcript: Ll_transcript_313492
• CDS coordinates: 1489-2331 (+)
• Peptide sequence: MQNVSREEYLASLRRKSSGFSRGLSKYRALSSRWEPSYGRIAGSDFFNSMHYGHDSVAESEYASDFCLERKIDLTSHIKWWGSNKSRQPDAGTRLSEEKKHGFAGDVCSELKMLEQKVQPTEPYQMPELGRSHNEKKHRSSSVSALSILSQSAAYKSLQEKASKRQENNTDNDEIENKNSVNKLDHGKSVEKSSNHDGGSDQLDIAIGTSGALSLQRNIYPLTPFLSAPLLTAYNTVDPSLVDPVLWTSLVPMLSAGLSRPTEVTKTETSSSYTIFQPEE*
• ORF Type: complete

Annotations of Ll_transcript_313492

• Blastp: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 50.34% of identity
• Blastx: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 60% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G41710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444051.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;