Protein coding transcript 32204

• Transcript: Ll_transcript_313493
• CDS coordinates: 153-875 (+)
• Peptide sequence: MASSSSDPAKSEIGAAAAETSEAAALPVAAMNDQALMYRGLKKAKKERGCTAKERISKMPPCAAGKRSSIYRGVTRHRWTGRYEAHLWDKSTWNQNQNKKGKQVYLGAYDDEEAAARAYDLAALKYWGPGTLINFPVTDYTRDLEEMQNVSREEYLASLRRKSSGFSRGLSKYRALSRCESIKRLPNSFNNIDTYTQTNLYQLPLCFGTHSLLESYYNGCHGSVCFRFLAHILIVMLHPT*
• ORF Type: complete

Annotations of Ll_transcript_313493

• Blastp: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 47.92% of identity
• Blastx: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 84.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G41710)
• CantataDB: Link to cantataDB annotations (CNT0002638)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444051.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;