Protein coding transcript 32205

• Transcript: Ll_transcript_313472
• CDS coordinates: 212-811 (+)
• Peptide sequence: MASSSSDPGKSEIGGGAAETSEAAAVAVTNDQSLLYRGLKKAKKERGCTAKERISKMPPCAAGKRSSIYRGVTRHRWTGRYEAHLWDKSTWNQNQNKKGKQVYLGAYDDEEAAARAYDLAALKYWGPGTLINFPVTDYTRDLEEMQNVSREEYLASLRRKSSGFSRGLAKYRALSSRWEPSYSRIAGSDYFNSMHYGMY*
• ORF Type: complete

Annotations of Ll_transcript_313472

• Blastp: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 48.55% of identity
• Blastx: AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 86.71% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G41710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020213467.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;