Transcript | Ll_transcript_313482 |
---|---|
CDS coordinates | 639-1064 (+) |
Peptide sequence | MMPVYLGAYDDEEAAARAYDLAALKYWGPGTLINFPVTDYTRDLEEMQNVSREEYLASLRRKSSGFSRGLSKYRALSRCESIKRLPNSFNNIDTYTQTNLYQLPLCFVDGSHHMVVLLDLISSIVCIMVTIPLQKVNMQVIF |
ORF Type | 3prime_partial |
Blastp | Ethylene-responsive transcription factor WRI1 from Arabidopsis with 74.67% of identity |
---|---|
Blastx | AP2-like ethylene-responsive transcription factor At2g41710 from Arabidopsis with 94.37% of identity |
Eggnog | Transcription factor(ENOG410Y9IH) |
Kegg | Link to kegg annotations (AT3G54320) |
CantataDB | Link to cantataDB annotations (CNT0002638) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425551.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer