Protein coding transcript 32225

• Transcript: Ll_transcript_312994
• CDS coordinates: 482-1033 (+)
• Peptide sequence: MEKDAFVLCRVFHKNNIGPPNGQRYAPFVEEDWDDESGLVPGAQSAEPIFVAEQPCIESNDHVLCIEGRKDVEQDTQSVTKASFDVNKLPIETQSLLAVCKRESMAEFPSSPEKGDSKLMPDEYPSFQPDNHKAFSQIYKRRRYNLNNHLNASGDSIRTSQDPCSSTITTAATTLPTATAIPKP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_312994

• Blastp: NAC domain-containing protein 78 from Arabidopsis with 44.44% of identity
• Blastx: NAC domain-containing protein 78 from Arabidopsis with 71.43% of identity
• Eggnog: (NAC) domain-containing protein(ENOG410YG99)
• Kegg: Link to kegg annotations (AT5G04410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441018.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;