Transcript | Ll_transcript_312996 |
---|---|
CDS coordinates | 3-737 (+) |
Peptide sequence | KGYWKATGNDRPVRHEQRTVGLKKTLVFHSGRAPDGKRTNWVMHEYRLVDEELEKARTANVSSQDAFVLCRVFHKNNIGPPNGQRYAPFVEEDWDDESGLVPGAQSAEPIFVAEQPCIESNDHVLCIEGRKDVEQDTQSVTKASFDVNKLPIETQSLLAVCKRESMAEFPSSPEKGDSKLMPDEYPSFQPDNHKAFSQIYKRRRYNLNNHLNASGDSIRTSQDPCSSTITTAATTLPTATAIPKP |
ORF Type | internal |
Blastp | NAC domain-containing protein 78 from Arabidopsis with 56.48% of identity |
---|---|
Blastx | NAC domain-containing protein 78 from Arabidopsis with 56.48% of identity |
Eggnog | (NAC) domain-containing protein(ENOG410YG99) |
Kegg | Link to kegg annotations (AT5G04410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441018.1) |
Pfam | No apical meristem (NAM) protein (PF02365.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer