Protein coding transcript 32233

• Transcript: Ll_transcript_312983
• CDS coordinates: 2-349 (+)
• Peptide sequence: FFCVKDRKYPTGLRTNRATEAGYWKATGKDKEIFRGKSLVGMKKTLVFYKGRAPKGEKSNWVMHEYRLEGKFTVNYFSETAKVIIMNSIYLVSSVFSFTLKVTDFDVCFPFHFSE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_312983

• Blastp: NAC domain-containing protein 100 from Arabidopsis with 30.42% of identity
• Blastx: NAC domain-containing protein 100 from Arabidopsis with 85.37% of identity
• Eggnog: NAC domain-containing protein(ENOG410Y9QZ)
• Kegg: Link to kegg annotations (AT5G61430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438417.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;