Transcript | Ll_transcript_312986 |
---|---|
CDS coordinates | 318-875 (+) |
Peptide sequence | MFVSLFTFQNEWVICRVFQKSLSGEKIHISGIMKLNSYGNEFGSYVLPPTPMNDSVYVPCFSNPIDNVQRNNNQGGIFDPFTNPTYGVLSSPLQFSPTKVPPQTVTASFYTSTQGFHQVPANLPLHGSVYNMQDHTMMRNLYDNNNNGLKSDREMVNLSQETCLTTDMNGETSSVLSNFDGLWNY* |
ORF Type | complete |
Blastp | NAC domain-containing protein 100 from Arabidopsis with 31.89% of identity |
---|---|
Blastx | NAC domain-containing protein 100 from Arabidopsis with 85.37% of identity |
Eggnog | NAC domain-containing protein(ENOG410Y9QZ) |
Kegg | Link to kegg annotations (AT5G61430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451347.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer