Protein coding transcript 32265

• Transcript: Ll_transcript_313557
• CDS coordinates: 521-835 (+)
• Peptide sequence: MAATQACKEAIWIQRLVEELRHKQQKIIVYCDSQSALHMARNPAFHSRKKHIGVQYHFVIEVVEEGSVDMQNIHTKENLVDVMMKPIKIDKYISCRSSYDLLEM*
• ORF Type: complete

Annotations of Ll_transcript_313557

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 40.62% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 44.34% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001892)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020240016.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;