Protein coding transcript 32266

• Transcript: Ll_transcript_313559
• CDS coordinates: 2-397 (+)
• Peptide sequence: TEQSHSVSQIYIFSPKYLQCLLSVSHILYIEKCVRVYSTNSTDQQQLGERDKSTMLMLLYFHPNRNEKIGIGPQCIKVGWHPKYKDTRCFFIVRTDGTSEDFSYRKCIIGALEIVHPQKAKMRKKKWLQYA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_313559

• Blastp: DNA-directed RNA polymerase IV subunit 1 from Arabidopsis with 46.51% of identity
• Blastx: DNA-directed RNA polymerase IV subunit 1 from Arabidopsis with 46.51% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0086)
• Kegg: Link to kegg annotations (AT1G63020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447260.1)
• Pfam: Protein of unknown function (DUF3223) (PF11523.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;