Protein coding transcript 32293

• Transcript: Ll_transcript_312694
• CDS coordinates: 908-1276 (+)
• Peptide sequence: MHQDAHEFLNFLLNELVDILEKEDQAAKNDEETSPPSEKTANGPKNGLSNGAKKEPLVTWVHKNFQGILTNETRCLQCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_312694

• Blastp: Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 82.11% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 85.62% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ81)
• Kegg: Link to kegg annotations (AT2G22310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416530.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;