Protein coding transcript 32295

• Transcript: Ll_transcript_312697
• CDS coordinates: 1063-1395 (+)
• Peptide sequence: MKIKKPPHILVIHLKRFKYMEQLGRLKKLSYRVVFPLELKLSNTVENTDTEYSLFAVVVHVGSGPNHGHYISLVKSHNHWLFFDDENIEMIDESAVQTFFGSAQEYSSNTD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_312697

• Blastp: Ubiquitin carboxyl-terminal hydrolase 3 from Arabidopsis with 91.07% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 3 from Arabidopsis with 89.6% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ81)
• Kegg: Link to kegg annotations (AT4G39910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006585271.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF00443.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;