Protein coding transcript 32296

• Transcript: Ll_transcript_312686
• CDS coordinates: 1-411 (+)
• Peptide sequence: FRSYMHQDAHEFLNFLLNELVDILEKEAQTEKTDQEVSPTSEKAANGSKSGLANGAQKEHLVTWVHKNFQGILTNETRCLQCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTEMLNAQDKFFCDKCCSLQEAQK
• ORF Type: internal

Annotations of Ll_transcript_312686

• Blastp: Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 81.75% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 81.75% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ81)
• Kegg: Link to kegg annotations (AT2G22310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459737.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF00443.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;