Transcript | Ll_transcript_312693 |
---|---|
CDS coordinates | 1-315 (+) |
Peptide sequence | FRSYMHQDAHEFLNFLLNELVDILEKEAQTEKTDQEVSPTSEKAANGSKSGLANGAQKEHLVTWVHKNFQVTLLCQFNALVLAFACSKTWEGPQIVNSVLNPVN* |
ORF Type | 5prime_partial |
Blastp | Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 68.49% of identity |
---|---|
Blastx | Ubiquitin carboxyl-terminal hydrolase 4 from Arabidopsis with 68.49% of identity |
Eggnog | ubiquitin carboxyl-terminal hydrolase(ENOG410XQ81) |
Kegg | Link to kegg annotations (AT2G22310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459737.1) |
Pfam | Ubiquitin carboxyl-terminal hydrolase (PF00443.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer