Protein coding transcript 32341

• Transcript: Ll_transcript_314256
• CDS coordinates: 139-507 (+)
• Peptide sequence: MREMQERFAGRKVMLGIDRLDMIKGIPQKILAFEQFLEENPHWHDKVVLLQIAVPTRTDCPEYQKLTSQVHEIVGRINGRFGTLTAVPIHHLDRSLDFHALCALYAVTGTHFLQKNTIFSPSC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_314256

• Blastp: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 91.67% of identity
• Blastx: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 89.23% of identity
• Eggnog: synthase(COG0380)
• Kegg: Link to kegg annotations (AT1G78580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461331.1)
• Pfam: Glycosyltransferase family 20 (PF00982.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;