Transcript | Ll_transcript_314256 |
---|---|
CDS coordinates | 139-507 (+) |
Peptide sequence | MREMQERFAGRKVMLGIDRLDMIKGIPQKILAFEQFLEENPHWHDKVVLLQIAVPTRTDCPEYQKLTSQVHEIVGRINGRFGTLTAVPIHHLDRSLDFHALCALYAVTGTHFLQKNTIFSPSC |
ORF Type | 3prime_partial |
Blastp | Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 91.67% of identity |
---|---|
Blastx | Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 89.23% of identity |
Eggnog | synthase(COG0380) |
Kegg | Link to kegg annotations (AT1G78580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461331.1) |
Pfam | Glycosyltransferase family 20 (PF00982.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer