Protein coding transcript 32351

• Transcript: Ll_transcript_314278
• CDS coordinates: 241-879 (+)
• Peptide sequence: MAFETAYSSLSLPNSTTFLHSSSSSNIRRLKSTSLPSRFFFNFQSQRIVLTPKKLVVMKPCAVRIEEKNSNVAGSEGGEWEKVSAVLFDMDGVLCNSEEPSRRAAVDLFAEIGVHVTVDDFVPFTGTGEANFLGGVASVKGVKGFDIEAAKKRFFEIYLDKYAKPDSGIGFPGAFELISQCKNKGLKVAVASSADRIKVDANLAAAALPLSM*
• ORF Type: complete

Annotations of Ll_transcript_314278

• Blastp: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic from Arabidopsis with 82.84% of identity
• Blastx: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic from Arabidopsis with 68.32% of identity
• Eggnog: HAD-superfamily hydrolase subfamily IA variant 3(COG0637)
• Kegg: Link to kegg annotations (AT1G56500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422618.1)
• Pfam: Haloacid dehalogenase-like hydrolase (PF13419.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;