Protein coding transcript 32376

• Transcript: Ll_transcript_313212
• CDS coordinates: 1-729 (+)
• Peptide sequence: PKCNSGHTRPNPFPSIETSFQLYSINLRFSLPFYQFMLRHLPFPNPNLRHQWFRQKSSGGRRPKKKIYHRVPELDRVMHLRKKPSSILHLNSILQSQHKTNHSILLRDLEKHVGFVQKWDFMSLIERYPTIFRVGGVPPSVSLTAKAEKVAAEEGRARMMMEPLLVDKLRKLLMLCVDCRVPVETVELVGSELGLPCDFKESFIPKYSQFFAVKNFKGRDWLELEDWDSSLAVTARETRKEF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_313212

• Blastp: Protein ROOT PRIMORDIUM DEFECTIVE 1 from Arabidopsis with 30.16% of identity
• Blastx: Protein ROOT PRIMORDIUM DEFECTIVE 1 from Arabidopsis with 36.54% of identity
• Eggnog: Plant organelle RNA recognition domain(ENOG410YAEM)
• Kegg: Link to kegg annotations (AT4G33495)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449282.1)
• Pfam: Plant organelle RNA recognition domain (PF11955.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;