Protein coding transcript 324

• Transcript: Ll_transcript_499598
• CDS coordinates: 250-888 (+)
• Peptide sequence: MPIQVIANKNLITHFRYIVSLQIHKERKKNTINMEGGTLSLYRECLRNHAANLGSYATDGCGEFTLDDMSLGGSLRCAACGCHRSFHRKVIMTQKVSNGRDPQMITAEFMDHSDGGGGGGEGRVVANVEGERKGSGKKRFRTKFTNEQKEKMLGFAEKIGWKLQRKELDDEIERFCKSVGVCRQVFKVWMHNHKHTSSSLSAFIGNVSSLTQ*
• ORF Type: complete

Annotations of Ll_transcript_499598

• Blastp: Zinc-finger homeodomain protein 4 from Arabidopsis with 42.41% of identity
• Blastx: Zinc-finger homeodomain protein 11 from Oryza sativa with 44.19% of identity
• Eggnog: ZF-HD protein dimerisation region containing protein, expressed(ENOG410YG6U)
• Kegg: Link to kegg annotations (AT1G14440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433188.1)
• Pfam: ZF-HD protein dimerisation region (PF04770.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;