Protein coding transcript 3240

• Transcript: Ll_transcript_308541
• CDS coordinates: 3-584 (+)
• Peptide sequence: GLLFLHQTKPEPLVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADSVTQYYMTAAAGTFCYIDPEYQQTGKLTTKSDIYSLGIVLLQIITAKPPMGIAHHVKRAIDNESFSDMLDPVVTDWPVDEALAFAKLALKCAELSKKDRPNLALVVVPELNRLRDFGYTSQDNQIKSGSHSPLPPTPRRNSHSIA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_308541

• Blastp: U-box domain-containing protein 34 from Arabidopsis with 50.55% of identity
• Blastx: U-box domain-containing protein 34 from Arabidopsis with 50.55% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G19410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457813.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;