Transcript | Ll_transcript_313268 |
---|---|
CDS coordinates | 1453-1968 (+) |
Peptide sequence | MFFLARYCKLLEENSFRGRTYDFLYMLLFGGTVLTGIVLLGGMIPYLSESFGKIIFLSNSLTFMMVYVWSKQNPFIHMNFLGLFTFTAAYLPWVLLGFSVLVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADDTVVVARPDNVRFAPPPAEQLHQD* |
ORF Type | complete |
Blastp | Derlin-2.2 from Arabidopsis with 85.96% of identity |
---|---|
Blastx | Derlin-2.2 from Arabidopsis with 74.3% of identity |
Eggnog | Derlin 1(COG5291) |
Kegg | Link to kegg annotations (AT4G04860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439814.1) |
Pfam | Der1-like family (PF04511.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer