Protein coding transcript 32442

• Transcript: Ll_transcript_313272
• CDS coordinates: 1695-2210 (+)
• Peptide sequence: MFFLARYCKLLEENSFRGRTADFLYMLLFGASVLTGIVLLGGMIPYLSESFAKIIFLSNSLTFMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVLVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADDTVVVARPANVRFAPPPAEELHQD*
• ORF Type: complete

Annotations of Ll_transcript_313272

• Blastp: Derlin-2.2 from Arabidopsis with 89.47% of identity
• Blastx: Derlin-2.2 from Arabidopsis with 89.33% of identity
• Eggnog: Derlin 1(COG5291)
• Kegg: Link to kegg annotations (AT4G04860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439814.1)
• Pfam: Der1-like family (PF04511.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;