Transcript | Ll_transcript_313385 |
---|---|
CDS coordinates | 392-721 (+) |
Peptide sequence | MLIAKEEIFGPVQSIFKFKDIGEVIERANNTRYGLAAGVFTKNIDTANTLTRALRAGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL* |
ORF Type | complete |
Blastp | Aldehyde dehydrogenase family 2 member B7, mitochondrial from Arabidopsis with 79.82% of identity |
---|---|
Blastx | Aldehyde dehydrogenase family 2 member B7, mitochondrial from Arabidopsis with 79.8% of identity |
Eggnog | Dehydrogenase(COG1012) |
Kegg | Link to kegg annotations (AT1G23800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421760.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer