Protein coding transcript 32470

• Transcript: Ll_transcript_313402
• CDS coordinates: 534-863 (+)
• Peptide sequence: MLIAKEEIFGPVQSILKFKDLDEVIRRANDSPYGLAAGVFTKNIDTANTLTRALRAGSVFVNCYDIFDAGVPFGGYKMSGHGREKGEYGLRNYLQVKAVVTPLVNPAWL*
• ORF Type: complete

Annotations of Ll_transcript_313402

• Blastp: Aldehyde dehydrogenase family 2 member B4, mitochondrial from Arabidopsis with 74.31% of identity
• Blastx: Aldehyde dehydrogenase family 2 member B7, mitochondrial from Arabidopsis with 75.16% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT3G48000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424457.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;