Protein coding transcript 327

• Transcript: Ll_transcript_465630
• CDS coordinates: 107-520 (+)
• Peptide sequence: MGMHSIFSGYIFFFIIHLLFLEGMSSGSGLDSSKCDFFTGKWVKDVSYPLYRPEMCPFIEREFRCQGNGRPDLIYTHYRWQPLGCNLLRFNGQDFLKRVRGKSIMFVGDSLSRNQWQSLTCMLHSSVPNSNYTLDRVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_465630

• Blastp: Protein trichome birefringence-like 41 from Arabidopsis with 71.15% of identity
• Blastx: Protein trichome birefringence-like 41 from Arabidopsis with 71.15% of identity
• Eggnog: Pfam:DUF231(ENOG41118PY)
• Kegg: Link to kegg annotations (AT3G14850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455246.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;