Protein coding transcript 32734

• Transcript: Ll_transcript_311975
• CDS coordinates: 206-781 (+)
• Peptide sequence: MAPLPMMNDTTFANGGPSNTPPFHLSEIWQFPPPALTDSGIGPRRPPFEQGLSHFSGFGPNRDVPRNDPINSEHMAPIPNRKRRDSDEESVKAASTSNGGGANAMSDGGDGKRVKTTGDNRNESGKGETETSSGKHAEQEQTTPEPPLKQDYIHVRARRGQATDSHSLAERVIHMFPSFVYTNIPLCGSAM*
• ORF Type: complete

Annotations of Ll_transcript_311975

• Blastp: Transcription factor BPE from Arabidopsis with 38.92% of identity
• Blastx: Transcription factor bHLH79 from Arabidopsis with 37.29% of identity
• Eggnog: Transcription factor(ENOG410YAFX)
• Kegg: Link to kegg annotations (AT1G59640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422701.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;