Transcript | Ll_transcript_311976 |
---|---|
CDS coordinates | 98-532 (+) |
Peptide sequence | MKSDGGDGKRVKTTGDNRNESGKGETETSSGKHEEQKQTTPEPHPKQDYIHVRARRGQATDSHSLAERARREKISERMKILQDLVPGCNKVIGKALVLDEIINYIQSLQRQVEFLSMKLEAVNSRLTPSMEVFPPKDVSIKQHP* |
ORF Type | complete |
Blastp | Transcription factor BPE from Arabidopsis with 79.83% of identity |
---|---|
Blastx | Transcription factor BPE from Arabidopsis with 64.56% of identity |
Eggnog | Transcription factor(ENOG410YAFX) |
Kegg | Link to kegg annotations (AT1G59640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422701.1) |
Pfam | Helix-loop-helix DNA-binding domain (PF00010.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer